PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676786170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ARF
Protein Properties Length: 1281aa    MW: 141838 Da    PI: 6.715
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676786170genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B365.57.9e-21206293183
                EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F 
  676786170 206 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI 293
                99*****************************98888885.9*********************************************995 PP

2Auxin_resp117.31.3e-38347429183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
   676786170 347 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 429
                 799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.09E-38196349IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-37200336IPR015300DNA-binding pseudobarrel domain
CDDcd100177.08E-20205310No hitNo description
PfamPF023626.4E-19206293IPR003340B3 DNA binding domain
PROSITE profilePS5086311.124206323IPR003340B3 DNA binding domain
SMARTSM010192.1E-17206307IPR003340B3 DNA binding domain
PfamPF065071.1E-33347429IPR010525Auxin response factor
PfamPF023093.6E-911521240IPR033389AUX/IAA domain
PROSITE profilePS5174526.17411541247IPR000270PB1 domain
SuperFamilySSF542771.18E-811671232No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1281 aa     Download sequence    Send to blast
MSAHLLVVVL VADHPFPTTL MKPVSQFNPL DAPIKESRER AESGGRKQLA SVFDCAGEKV  60
LSFKVEGEDE ALTSLSLVIM KAPSSNGVSP NPVEGERRNI NSELWHACAG PLISLPPAGS  120
LVVYFPQGHS EQVAASMQKQ TDFIPSYPNL PSKLICMLHN VTLNADPETD EVYAQMTLQP  180
VNKYDRDALL ASDMGLKLNR QPNEFFCKTL TASDTSTHGG FSVPRRAAEK IFPALDFSMQ  240
PPCQELVAKD IHDNTWTFRH IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFISFYLVTM  300
LTLFHFQLRD GKAQLLLGIR RANRQQPALS SSVISSDSMH IGVLAAAAHA NANNSPFTIF  360
YNPRAAPAEF VVPLAKYTKA MYAQVSLGMR FRMIFETEEC GVRRYMGTVT GISDLDPVRW  420
KNSQWRNLQI GWDESAAGDR PSRVSVWDIE PVLTPFYICP PPFFRPRFAG PPGMPDDETD  480
MESALKRAMP WLDNSLDMKD PSSTIFPGLS LVQWMNMQQP HGQVPSAAAQ PGFFPSMLSP  540
TAGLHNNLGG TDDPSKLLSF QTPPGGIASS NIQFNKPNPQ AAMSQLPQPP TTLSQQQQLQ  600
QLLHSSLNHQ QPQSQPQQQP QSLQQQQQQQ QSLQQQQQQQ QQSLQQHQQQ QQQQSLQQHQ  660
QQQQQSLQQH QQQQQQSLQQ HHQQPLQQQS QQLQQQQQPR TQQLQSLSHP QPQSQPQQLQ  720
QFQLPQNQLY NGQQATQQHQ AQQASMHHLQ PQVVSGSMAS SVIVPPSSSL NQSFQQQQQP  780
TQLHHTHRHL GASTSQSSVI ETSKSSSNLI SIPPQDTQFP RQVEQQQSSG LVKGHNQQTL  840
EQQKAQQAQV QQIFQQSLLE QPHLQFQLLQ RLQQQQQFLS PGSSSLQSQL LHQQLQSQQS  900
QQIPSLSQGQ QFPSSCTNTG LSTLQPPQML VSRPQDKQNP PVGGAKAYSG ITDGGDAPSS  960
STSPSTNNCQ ISSSSFLNRS QSGPAILIPD AAVDMSGSLV QDLYSKSDMR PKHELVGQQK  1020
PKASLTDHQL EASASGTSYG LDGAENNRQQ NFLSPNFGLD VDSRNNLLGG ANVENGFVPD  1080
TLLSRGYDSQ KDLQNMLSNY GGVTNDIGTE MSTSAVRTQS FGIPNVPAIS NDVAVNDAGV  1140
LGGGLWPTQT QRMRTYTKVQ KRGSVGRSID VNRYRGYDEL RHDLARMFGI EGQLEDPLTS  1200
DWKLVYVDHE NDILLVGDDP WEEFVNCVQS IKILSSAEVQ QMSLDGNFAG LPATNQACSG  1260
GDSGNAWRGH YDDNSATSFN R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-16310045051388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794690.0JN979469.1 Brassica rapa subsp. pekinensis auxin response factor 7-1 (ARF7-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM4CDP60.0M4CDP6_BRARP; Auxin response factor
STRINGBra002327.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein